PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002471m
Common NameCICLE_v10002471mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24829.2 Da    PI: 8.6355
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002471mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF892.4e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien snrqvt+skRrngilKKA+E+ vLCda+v++ii++s+gk+++y+s
  Ciclev10002471m  9 KRIENASNRQVTYSKRRNGILKKAKEITVLCDAKVSLIIYASSGKMHDYCS 59
                     79***********************************************96 PP

2K-box79.67.7e-2771167197
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                      y+++sg++l++ k+e+l++e++++k+e++ +q ++Rhl Ged++sL+ keL  Le++Le++l +iR+k++e + ++ ++ +++e+e++  +  L
  Ciclev10002471m  71 YHRQSGRRLWDPKHENLSNEIERIKRENDRMQIKLRHLNGEDISSLNPKELIALEDALENGLVSIRDKQSEKMETMRKNGKMMEEEHNYLKFVL 164
                      78899999****************************************************************9999999999999999999999 PP

            K-box  95 rkk 97 
                      r++
  Ciclev10002471m 165 RQQ 167
                      887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002651.03E-38280No hitNo description
SuperFamilySSF554551.96E-34295IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1883162IPR002487Transcription factor, K-box
PROSITE profilePS5129714.0584170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRGKIEIKR IENASNRQVT YSKRRNGILK KAKEITVLCD AKVSLIIYAS SGKMHDYCSP  60
STSLVDILEQ YHRQSGRRLW DPKHENLSNE IERIKRENDR MQIKLRHLNG EDISSLNPKE  120
LIALEDALEN GLVSIRDKQS EKMETMRKNG KMMEEEHNYL KFVLRQQEIA RQQQELAMEN  180
SVSAEIDYQR ENHHDYAYHV QPIQPNLQER I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-16196190Myocyte-specific enhancer factor 2B
1tqe_Q9e-16196190Myocyte-specific enhancer factor 2B
1tqe_R9e-16196190Myocyte-specific enhancer factor 2B
1tqe_S9e-16196190Myocyte-specific enhancer factor 2B
3mu6_A8e-16271168Myocyte-specific enhancer factor 2A
3mu6_B8e-16271168Myocyte-specific enhancer factor 2A
3mu6_C8e-16271168Myocyte-specific enhancer factor 2A
3mu6_D8e-16271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434291.11e-155hypothetical protein CICLE_v10002471mg
SwissprotQ074745e-94MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLV4TCY61e-155V4TCY6_9R
STRINGPOPTR_0005s20480.17e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-87MIKC_MADS family protein